Overview

  • Product name

  • Description

    Rabbit polyclonal to SPON2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPON2 aa 220-314. (Natural variant V to L at aa 242).
    Sequence:

    HPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSA SVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGS


    Database link: Q9BUD6

  • Positive control

    • Human kidney tissue; SPON2 overexpression HEK293T lysate (with a C-terminal myc-DDK tag (~3.1 kDa)).

Properties

Applications

Our Abpromise guarantee covers the use of ab215451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 36 kDa.

Target

  • Function

    Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens (By similarity). Binds bacterial lipopolysaccharide (LPS).
  • Tissue specificity

    Expressed in normal lung tissue but not in lung carcinoma cell lines.
  • Sequence similarities

    Contains 1 spondin domain.
    Contains 1 TSP type-1 domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Differentially expressed in cancerous and non-cancerous lung cells 1 antibody
    • DIL 1 antibody
    • DIL-1 antibody
    • DIL1 antibody
    • DKFZp686G21139 antibody
    • FLJ16313 antibody
    • FLJ22401 antibody
    • FLJ34460 antibody
    • M spondin antibody
    • Mindin antibody
    • ORF Names: antibody
    • SPON 2 antibody
    • Spon2 antibody
    • SPON2_HUMAN antibody
    • Spondin 2 antibody
    • Spondin 2 extracellular matrix protein antibody
    • Spondin-2 antibody
    see all

Images

  • All lanes : Anti-SPON2 antibody (ab215451) at 1/100 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : SPON2 overexpression HEK293T lysate (with a C-terminal myc-DDK tag (~3.1 kDa))

    Predicted band size: 36 kDa

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling SPON2 with ab215451 at 1/50 dilution.

References

ab215451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up