Overview

  • Product name

    Anti-SPP antibody - C-terminal
    See all SPP primary antibodies
  • Description

    Rabbit polyclonal to SPP - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cat, Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human SPP aa 327-377 (C terminal). The exact sequence is proprietary. NP_110416.1.
    Sequence:

    IGFPVLVALAKGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKE K


    Database link: Q8TCT9

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysate (ab7899).
  • General notes

     This product was previously labelled as Signal Peptide Peptidase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab190253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 41 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection (By similarity). May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1.
  • Tissue specificity

    Widely expressed with highest levels in kidney, liver, placenta, lung, leukocytes and small intestine and reduced expression in heart and skeletal muscle. Expressed abundantly in the CNS with highest levels in thalamus and medulla.
  • Sequence similarities

    Belongs to the peptidase A22B family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane and Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ324O17.1 antibody
    • H13 antibody
    • hIMP1 antibody
    • Histocompatibility (minor) 13 antibody
    • HM13 antibody
    • HM13_HUMAN antibody
    • IMP-1 antibody
    • IMP1 antibody
    • IMPAS antibody
    • IMPAS-1 antibody
    • Intramembrane protease 1 antibody
    • Intramembrane protease antibody
    • Minor histocompatibility antigen 13 antibody
    • Minor histocompatibility antigen H13 antibody
    • MSTP086 antibody
    • OTTHUMP00000030527 antibody
    • OTTHUMP00000030528 antibody
    • OTTHUMP00000030530 antibody
    • OTTHUMP00000214528 antibody
    • Presenilin-like protein 3 antibody
    • PSENL3 antibody
    • PSL3 antibody
    • Signal peptide peptidase antibody
    • Signal peptide peptidase beta antibody
    • SPP antibody
    see all

Images

  • Detection of SPP in immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab190253 at 6 µg/reaction for IP and 1 µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 3 minutes.

  • All lanes : Anti-SPP antibody - C-terminal (ab190253) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 41 kDa


    Exposure time: 3 minutes

References

This product has been referenced in:

  • Stefanovic-Barrett S  et al. MARCH6 and TRC8 facilitate the quality control of cytosolic and tail-anchored proteins. EMBO Rep N/A:N/A (2018). Read more (PubMed: 29519897) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up