Overview

  • Product name

    Anti-SPPL2a antibody
  • Description

    Rabbit polyclonal to SPPL2a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPPL2a aa 26-172.
    Sequence:

    QEAILHASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNL SDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSG NRSEFPDVKILIAFISYKDFRDMNQTLGDNITVKMYSPSWPNFDYTM


    Database link: Q8TCT8

  • Positive control

    • WB: Jurkat whole cell lysate. ICC/IF: HeLa cells. IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000. Predicted molecular weight: 58 kDa.

Target

  • Relevance

    This protein, which may act as an intramembrane protease, contains an N-terminal protease-associated (PA) domain, several transmembrane regions, a hydrophilic loop, conservative sequences around the first and second aspartate residues, and an invariant PAL motif near the C terminus.
  • Cellular localization

    Cell Membrane; multi-pass membrane protein
  • Database links

  • Alternative names

    • EC 3.4.99 antibody
    • IMP3 antibody
    • Intramembrane protease 3 antibody
    • Presenilin like protein 2 antibody
    • PSL2 antibody
    • Signal peptide peptidase like 2A antibody
    • SPP like 2A protein antibody
    see all

Images

  • Anti-SPPL2a antibody (ab237691) at 1/2000 dilution + Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 58 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SPPL2a (Green) using ab237691 at 1/100 dilution in ICC/IF analysis, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human prostate cancer tissue stained for SPPL2a using ab237691 at 1/100 dilution in immunohistochemical analysis.

References

ab237691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up