Overview

  • Product name

  • Description

    Rabbit polyclonal to SPPL3/IMP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SPPL3/IMP2 aa 213-263.
    Sequence:

    SNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGS H


    Database link: Q8TCT6-1

  • Positive control

    • WB: HeLa, HepG2, Jurkat and MCF7 whole cell lysates. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as SPPL3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab234720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/2000. Predicted molecular weight: 43 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus. Membrane.
  • Database links

  • Alternative names

    • IMP2 antibody
    • Intramembrane protease 2 antibody
    • MDHV1887 antibody
    • Presenilin homologous protein 1 antibody
    • Presenilin like protein 4 antibody
    • PRO4332 antibody
    • PSH1 antibody
    • PSL4 antibody
    • Signal peptide peptidase like 3 antibody
    • SPP like 3 antibody
    see all

Images

  • All lanes : Anti-SPPL3/IMP2 antibody (ab234720) at 1/200 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for SPPL3/IMP2 using ab234720 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up