Overview

  • Product name

  • Description

    Rabbit polyclonal to SPRED1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human SPRED1 aa 1-444.
    Sequence:

    MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQ EENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFG LTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSS LVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQP GLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINP RDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDET KLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRG KCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKF CLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG


    Database link: Q7Z699

  • Positive control

    • Human liver tissue, Jurkat cells, Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab191278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/75. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

WB 1/1000. Predicted molecular weight: 50 kDa.

Target

  • Function

    Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow.
  • Tissue specificity

    Weakly expressed in embryonic cell line (HEK-293).
  • Involvement in disease

    Defects in SPRED1 are the cause of Legius syndrome (LEGIUSS) [MIM:611431]. It is a disorder characterized mainly by cafe au lait macules without neurofibromas or other tumor manifestations of neurofibromatosis type 1, axillary freckling, and macrocephaly. Additional clinical manifestations include Noonan-like facial dysmorphism, lipomas, learning disabilities and attention deficit-hyperactivity.
  • Sequence similarities

    Contains 1 KBD domain.
    Contains 1 SPR (sprouty) domain.
    Contains 1 WH1 domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine.
  • Cellular localization

    Cell membrane. Membrane > caveola. Nucleus. Localized in cholesterol-rich membrane raft/caveola fractions.
  • Information by UniProt
  • Database links

  • Alternative names

    • EVH1 domain-containing protein 1 antibody
    • EVH1/Sprouty domain containing protein antibody
    • FLJ33903 antibody
    • hSpred 1 antibody
    • hSpred1 antibody
    • NFLS antibody
    • PPP1R147 antibody
    • protein phosphatase 1 regulatory subunit 147 antibody
    • SPRE1_HUMAN antibody
    • SPRED 1 antibody
    • Spred-1 antibody
    • spred1 antibody
    • Sprouty related EVH1 domain containing 1 antibody
    • sprouty related EVH1 domain containing protein 1 antibody
    • Sprouty related protein 1 with EVH 1 domain antibody
    • Sprouty-related antibody
    • Suppressor of Ras/MAPK activation antibody
    see all

Images

  • Anti-SPRED1 antibody (ab191278) at 1/1000 dilution + Jurkat cell lysate at 35 µg

    Predicted band size: 50 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human liver tissue, labeling SPRED1 with ab191278 at 1/75 dilution.

  • Flow cytometric analysis of Jurkat cells (bottom histogram) compared to a negative control cell (top histogram), labeling SPRED1 with ab191278 at 1/10 dilution. FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

References

ab191278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up