Anti-SPRR3 antibody (ab218131)
Key features and details
- Rabbit polyclonal to SPRR3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SPRR3 antibody -
Description
Rabbit polyclonal to SPRR3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Synthetic peptide within Human SPRR3 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:QEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPE P
Database link: Q9UBC9 -
Positive control
- Human laryngocarcinoma tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab218131 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Cross-linked envelope protein of keratinocytes. -
Sequence similarities
Belongs to the cornifin (SPRR) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 6707 Human
- Entrez Gene: 20766 Mouse
- Entrez Gene: 310575 Rat
- Omim: 182271 Human
- SwissProt: Q9UBC9 Human
- SwissProt: O09116 Mouse
- SwissProt: D3ZHQ6 Rat
- Unigene: 139322 Human
see all -
Alternative names
- 22 kDa pancornulin antibody
- Cornifin beta antibody
- Esophagin antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SPRR3 antibody (ab218131)Immunohistochemical analysis of formalin-fixed paraffin-embedded Human laryngocarcinoma tissue, labeling SPRR3 using ab218131 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab218131 has not yet been referenced specifically in any publications.
