Overview

  • Product name
  • Description
    Rabbit polyclonal to SPTLC1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Synthetic peptide within Human SPTLC1 aa 50-100. The exact sequence is proprietary. NP_006406.1.
    Sequence:

    SDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKE C


    Database link: O15269

  • Positive control
    • HeLa, 293T, Jurkat and NIH3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 53 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Serine palmitoyltransferase (SPT). The heterodimer formed with LCB2 (SPTLC2 or SPTLC3) constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SSSPTA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SSSPTA isozyme uses both C14-CoA and C16-CoA as substrates, with a slight preference for C14-CoA. The SPTLC1-SPTLC2-SSSPTB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SSSPTB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference.
  • Tissue specificity
    Widely expressed. Not detected in small intestine.
  • Pathway
    Lipid metabolism; sphingolipid metabolism.
  • Involvement in disease
    Defects in SPTLC1 are the cause of hereditary sensory and autonomic neuropathy type 1A (HSAN1A) [MIM:162400]. The hereditary sensory and autonomic neuropathies are a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN1A is an autosomal dominant axonal neuropathy with onset in the second or third decades. Initial symptoms are loss of pain, touch, heat, and cold sensation over the feet, followed by distal muscle wasting and weakness. Loss of pain sensation leads to chronic skin ulcers and distal amputations.
  • Sequence similarities
    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • HSAN antibody
    • HSAN1 antibody
    • HSN1 antibody
    • LBC1 antibody
    • LCB 1 antibody
    • LCB1 antibody
    • Long chain base biosynthesis protein 1 antibody
    • MGC14645 antibody
    • Serine C palmitoyltransferase antibody
    • Serine palmitoyl CoA transferase 1 antibody
    • Serine palmitoyltransferase 1 antibody
    • Serine palmitoyltransferase long chain base subunit 1 antibody
    • Serine palmitoyltransferase subunit 1 antibody
    • Serine-palmitoyl-CoA transferase 1 antibody
    • SPT 1 antibody
    • SPT1 antibody
    • SPTC1_HUMAN antibody
    • SPTI antibody
    • SPTLC 1 antibody
    • SPTLC1 antibody
    see all

Images

  • All lanes : Anti-SPTLC1 antibody (ab176706) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 53 kDa


    Exposure time: 30 seconds
  • ab176706 at 0.4 µg/ml detecting SPTLC1 in HeLa whole cell lysate by WB following IP. 

    Lane 1: ab176706 at 6 µg/mg of lysate
    Lane 2: IP with an antibody which recognizes an downstream epitope of SPTLC1.
    Lane 3: Control IgG. 

    In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

References

This product has been referenced in:
  • Pesciotta EN  et al. Dysferlin and other non-red cell proteins accumulate in the red cell membrane of Diamond-Blackfan Anemia patients. PLoS One 9:e85504 (2014). WB ; Human . Read more (PubMed: 24454878) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up