Overview

  • Product name

  • Description

    Rabbit polyclonal to SPTLC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SPTLC3 aa 1-58.
    Sequence:

    MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKL IVESFEEA


    Database link: Q9NUV7

  • Positive control

    • RT-4, U-251 MG cell lysates; HepG2 cells.
  • General notes

     This product was previously labelled as Serine palmitoyltransferase 3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab220611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 62 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1/SPTLC1 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC3-SSSPTA isozyme uses both C14-CoA and C16-CoA as substrates, while the SPTLC1-SPTLC3-SSSPTB has the ability to use a broader range of acyl-CoAs without apparent preference.
  • Tissue specificity

    Expressed in most tissues, except peripheral blood cells and bone marrow, with highest levels in heart, kidney, liver, uterus and skin.
  • Pathway

    Lipid metabolism; sphingolipid metabolism.
  • Sequence similarities

    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • LCB 3 antibody
    • LCB2b antibody
    • Long chain base biosynthesis protein 2b antibody
    • Long chain base biosynthesis protein 3 antibody
    • Serine palmitoyltransferase 3 antibody
    • Serine-palmitoyl-CoA transferase 3 antibody
    • SPT 3 antibody
    • SPTC3_HUMAN antibody
    • SPTLC3 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HepG2 cells labeling SPTLC3 with ab220611 at 4 μg/ml (green).

  • All lanes : Anti-SPTLC3 antibody (ab220611) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 62 kDa

References

ab220611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up