Overview

  • Product name

  • Description

    Rabbit polyclonal to SPTLC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse SPTLC3 aa 80-563. Expressed in E. coli. N-terminal tags.
    Sequence:

    RDFMRNWGIEKCNAAVEREEQKDFVPLYQDFENFYKRNLYMRIRDSWSHT VCSAPEPYMNVMEKVTDDYNWTFRHTGKVIENIINMASYNYLGLAGKYDD SMVRVKDTLEKYGVGVASTRNEMGTLDIHKELEDLMAEFLNVEAVMSFGM GFATNAMNIPVFVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNAEN LEKLLREAIIRGQPGTGRAWKKILIVVEGVYSMEGSIVNLAQIVALKKKY KAYLYIDEAHSIGCTGPTGRGVRELFGLDPEDIDVYMGTFTKSFSGSGGY IGGKKEIVDYLRMQSHSTTYATSMSPVVAAQLIRSLKITMGYEGNIGGME RIQQLKENIKYFRRRLKEMGFIIYGNDFSPVIPVLLYMPAKVSAFSRFLL KKKISVVVVGFPATSLPEGRARFSMSSAHTREMLDTVLEVVDELGDLLNV KYFPLKKSGRAILYNKEGFDNEASFEEMHSEPEA


    Database link: Q8BG54

  • Positive control

    • WB: Recombinant mouse SPTLC3 protein; HeLa and HEK-293T cell lysates. IHC-P: Mouse kidney tissue.
  • General notes

     This product was previously labelled as Serine palmitoyltransferase 3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab232829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Function

    Serine palmitoyltransferase (SPT). The heterodimer formed with LCB1/SPTLC1 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC3-SSSPTA isozyme uses both C14-CoA and C16-CoA as substrates, while the SPTLC1-SPTLC3-SSSPTB has the ability to use a broader range of acyl-CoAs without apparent preference.
  • Tissue specificity

    Expressed in most tissues, except peripheral blood cells and bone marrow, with highest levels in heart, kidney, liver, uterus and skin.
  • Pathway

    Lipid metabolism; sphingolipid metabolism.
  • Sequence similarities

    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • LCB 3 antibody
    • LCB2b antibody
    • Long chain base biosynthesis protein 2b antibody
    • Long chain base biosynthesis protein 3 antibody
    • Serine palmitoyltransferase 3 antibody
    • Serine-palmitoyl-CoA transferase 3 antibody
    • SPT 3 antibody
    • SPTC3_HUMAN antibody
    • SPTLC3 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for SPTLC3 with ab232829 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-SPTLC3 antibody (ab232829) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 63 kDa

  • Anti-SPTLC3 antibody (ab232829) at 2 µg/ml + Recombinant mouse SPTLC3 protein

    Predicted band size: 63 kDa

References

ab232829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up