Overview

  • Product name

    Anti-SPXN3 antibody [OTI1B2]
  • Description

    Mouse monoclonal [OTI1B2] to SPXN3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human SPXN3 aa 1-141. Produced in E.coli (NP_001009609).
    Sequence:

    MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYP IIFVYYLRKGKKINSNQLENEQSQENSINPIQKEEDEGVDLSEGSSNEDE DLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGED


    Database link: Q5MJ09

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY SPXN3 cDNA.
  • General notes

    Clone OTI1B2 (formerly 1B2).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1B2
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 16 kDa.

Target

Images

  • All lanes : Anti-SPXN3 antibody [OTI1B2] (ab236413) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with r pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SPXN3 cDNA

    Predicted band size: 16 kDa

References

ab236413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up