Anti-SQSTM1 / p62 antibody (ab233207)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SQSTM1 / p62 antibody
See all SQSTM1 / p62 primary antibodies -
Description
Rabbit polyclonal to SQSTM1 / p62 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human, Pig
Predicted to work with: Orangutan
-
Immunogen
Recombinant fragment (His-tag) corresponding to Human SQSTM1/ p62 aa 136-400. (Expressed in E.coli).
Sequence:VGTRYKCSVCPDYDLCSVCEGKGLHGHTKLAFPSPFGHLSEGFSHSRWLR KVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNF LKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQP SSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDD DWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHL PPEADPRLIESLSQ
Database link: Q13501 -
Positive control
- IHC-P: Human liver, prostate gland, stomach, stomach cancer, breast cancer and skin cancer tissue. WB: Human, mouse and pig liver tissue; HEK-293T cell lysate; Recombinant human SQSTM1 / p62 protein.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233207 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 48 kDa. |
Target
-
Function
Adapter protein which binds ubiquitin and may regulate the activation of NFKB1 by TNF-alpha, nerve growth factor (NGF) and interleukin-1. May play a role in titin/TTN downstream signaling in muscle cells. May regulate signaling cascades through ubiquitination. Adapter that mediates the interaction between TRAF6 and CYLD (By similarity). May be involved in cell differentiation, apoptosis, immune response and regulation of K(+) channels. -
Tissue specificity
Ubiquitously expressed. -
Involvement in disease
Defects in SQSTM1 are a cause of Paget disease of bone (PDB) [MIM:602080]. PDB is a metabolic bone disease affecting the axial skeleton and characterized by focal areas of increased and disorganized bone turn-over due to activated osteoclasts. Manifestations of the disease include bone pain, deformity, pathological fractures, deafness, neurological complications and increased risk of osteosarcoma. PDB is a chronic disease affecting 2 to 3% of the population above the age of 40 years. -
Sequence similarities
Contains 1 OPR domain.
Contains 1 UBA domain.
Contains 1 ZZ-type zinc finger. -
Domain
The UBA domain binds specifically 'Lys-63'-linked polyubiquitin chains of polyubiquitinated substrates. Mediates the interaction with TRIM55.
The OPR domain mediates homooligomerization and interactions with PRKCZ, PRKCI, MAP2K5 and NBR1.
The ZZ-type zinc finger mediates the interaction with RIPK1. -
Post-translational
modificationsPhosphorylated. May be phosphorylated by PRKCZ (By similarity). Phosphorylated in vitro by TTN. -
Cellular localization
Cytoplasm. Late endosome. Nucleus. Sarcomere (By similarity). In cardiac muscles localizes to the sarcomeric band (By similarity). Localizes to late endosomes. May also localize to the nucleus. Accumulates in neurofibrillary tangles and in Lewy bodies of neurons from individuals with Alzheimer and Parkinson disease respectively. Enriched in Rosenthal fibers of pilocytic astrocytoma. In liver cells, accumulates in Mallory bodies associated with alcoholic hepatitis, Wilson disease, indian childhood cirrhosis and in hyaline bodies associated with hepatocellular carcinoma. - Information by UniProt
-
Database links
- Entrez Gene: 8878 Human
- Entrez Gene: 18412 Mouse
- Entrez Gene: 100172461 Orangutan
- Omim: 601530 Human
- SwissProt: Q13501 Human
- SwissProt: Q64337 Mouse
- SwissProt: Q5RBA5 Orangutan
- Unigene: 709030 Human
see all -
Alternative names
- A170 antibody
- DMRV antibody
- EBI 3 associated protein of 60 kDa antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SQSTM1 / p62 antibody (ab233207)Formalin-fixed, paraffin-embedded human skin cancer tissue stained for SQSTM1 / p62 using ab233207 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SQSTM1 / p62 antibody (ab233207)Formalin-fixed, paraffin-embedded human breast cancer tissue stained for SQSTM1 / p62 using ab233207 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SQSTM1 / p62 antibody (ab233207)Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for SQSTM1 / p62 using ab233207 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SQSTM1 / p62 antibody (ab233207)Formalin-fixed, paraffin-embedded human stomach tissue stained for SQSTM1 / p62 using ab233207 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SQSTM1 / p62 antibody (ab233207)Formalin-fixed, paraffin-embedded human prostate gland tissue stained for SQSTM1 / p62 using ab233207 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SQSTM1 / p62 antibody (ab233207)Formalin-fixed, paraffin-embedded human liver tissue stained for SQSTM1 / p62 using ab233207 at 10 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-SQSTM1 / p62 antibody (ab233207)All lanes : Anti-SQSTM1 / p62 antibody (ab233207) at 2 µg/ml
Lane 1 : Human liver tissue lysate
Lane 2 : Pig liver tissue lysate
Lane 3 : Mouse liver tissue lysate
Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Predicted band size: 48 kDa -
Western blot - Anti-SQSTM1 / p62 antibody (ab233207)Anti-SQSTM1 / p62 antibody (ab233207) at 2 µg/ml + Recombinant human SQSTM1 / p62 protein
Predicted band size: 48 kDa
Datasheets and documents
References
ab233207 has not yet been referenced specifically in any publications.
