Overview

  • Product name

    Anti-SR protein repeat/SRSF6 antibody
    See all SR protein repeat/SRSF6 primary antibodies
  • Description

    Rabbit polyclonal to SR protein repeat/SRSF6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SR protein repeat/SRSF6 aa 266-327.
    Sequence:

    KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSV SPPPKRATSRSR


    Database link: Q13247

  • Positive control

    • IHC-P: Human gastrointestinal, prostate, tonsil and skeletal muscle tissues. WB: MOLT-4 and NIH/3T3 cell lysates.
  • General notes

     This product was previously labelled as SR protein repeat

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 40 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.
  • Sequence similarities

    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • arginine/serine-rich 6 antibody
    • B52 antibody
    • Epididymis secretory protein Li 91 antibody
    • fc17h09 antibody
    • HEL S 91 antibody
    • MGC128807 antibody
    • MGC5045 antibody
    • Pre mRNA splicing factor SRP55 antibody
    • Pre-mRNA-splicing factor SRP55 antibody
    • Serine/arginine-rich splicing factor 6 antibody
    • SFRS6 antibody
    • Splicing factor antibody
    • Splicing factor arginine/serine rich 55 kDa antibody
    • Splicing factor arginine/serine rich 6 antibody
    • SR splicing factor 6 antibody
    • SRP55 antibody
    • SRSF6 antibody
    • SRSF6_HUMAN antibody
    • wu:faa54g02 antibody
    • wu:fc17h09 antibody
    • zgc:103497 antibody
    see all

Images

  • Paraffin-embedded human gastrointestinal tissue stained for SR protein repeat/SRSF6 using ab244425 at 1/50 dilution in immunohistochemical analysis.

  • Anti-SR protein repeat/SRSF6 antibody (ab244425) at 0.4 µg/ml + MOLT-4 (human lymphoblastic leukemia cell line) cell lysate

    Predicted band size: 40 kDa

  • Paraffin-embedded human prostate tissue stained for SR protein repeat/SRSF6 using ab244425 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-SR protein repeat/SRSF6 antibody (ab244425) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 40 kDa

  • Immunohistochemical staining of human skeletal muscle shows moderate nuclear positivity in myocytes.

  • Paraffin-embedded human tonsil tissue stained for SR protein repeat/SRSF6 using ab244425 at 1/50 dilution in immunohistochemical analysis.

References

ab244425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up