Anti-SR140 antibody (ab195340)
Key features and details
- Rabbit polyclonal to SR140
- Suitable for: IP, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SR140 antibody -
Description
Rabbit polyclonal to SR140 -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human SR140 aa 1-50. The exact sequence is proprietary. NP_001073884.1
Sequence:MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSP
Database link: O15042 -
Positive control
- HeLa, 293T, Jurkat, Mouse TCMK-1 and Mouse NIH/3T3 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab195340 was affinity purified using an epitope specific to SR140 immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab195340 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP | Use at 2-10 µg/mg of lysate. | |
WB | 1/2000 - 1/10000. Predicted molecular weight: 118 kDa. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 460749 Chimpanzee
- Entrez Gene: 505019 Cow
- Entrez Gene: 477103 Dog
- Entrez Gene: 101146707 Gorilla
- Entrez Gene: 100051188 Horse
- Entrez Gene: 23350 Human
- Entrez Gene: 67958 Mouse
- Entrez Gene: 100174588 Orangutan
see all -
Alternative names
- 140 kDa Ser/Arg rich domain protein antibody
- 140 kDa Ser/Arg-rich domain protein antibody
- AU023006 antibody
see all
Images
-
All lanes : Anti-SR140 antibody (ab195340) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate prepared using NETN lysis buffer
Lane 2 : 293T whole cell lysate prepared using NETN lysis buffer
Lane 3 : Jurkat whole cell lysate prepared using NETN lysis buffer
Lane 4 : Mouse TCMK-1 whole cell lysate prepared using NETN lysis buffer
Lane 5 : Mouse NIH/3T3 whole cell lysate prepared using NETN lysis buffer
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 118 kDa
Exposure time: 30 seconds -
Detection of SR140 in Immunoprecipitates of 293T whole cell lysates prepared
using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab195340 at 6 µg per reaction for IP and at 0.1µg/ml for subsequent Western blot detection.
Detection: Chemiluminescence with an exposure time of 10 seconds.
Protocols
Datasheets and documents
References (0)
ab195340 has not yet been referenced specifically in any publications.