Anti-SR140 antibody (ab195340)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SR140 antibody -
Description
Rabbit polyclonal to SR140 -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Synthetic peptide within Human SR140 aa 1-50. The exact sequence is proprietary. NP_001073884.1
Sequence:MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSP
Database link: O15042 -
Positive control
- HeLa, 293T, Jurkat, Mouse TCMK-1 and Mouse NIH/3T3 whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab195340 was affinity purified using an epitope specific to SR140 immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab195340 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IP | Use at 2-10 µg/mg of lysate. | |
| WB | 1/2000 - 1/10000. Predicted molecular weight: 118 kDa. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 460749 Chimpanzee
- Entrez Gene: 505019 Cow
- Entrez Gene: 477103 Dog
- Entrez Gene: 101146707 Gorilla
- Entrez Gene: 100051188 Horse
- Entrez Gene: 23350 Human
- Entrez Gene: 67958 Mouse
- Entrez Gene: 100174588 Orangutan
see all -
Alternative names
- 140 kDa Ser/Arg rich domain protein antibody
- 140 kDa Ser/Arg-rich domain protein antibody
- AU023006 antibody
see all
Images
-
Western blot - Anti-SR140 antibody (ab195340)All lanes : Anti-SR140 antibody (ab195340) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate prepared using NETN lysis buffer
Lane 2 : 293T whole cell lysate prepared using NETN lysis buffer
Lane 3 : Jurkat whole cell lysate prepared using NETN lysis buffer
Lane 4 : Mouse TCMK-1 whole cell lysate prepared using NETN lysis buffer
Lane 5 : Mouse NIH/3T3 whole cell lysate prepared using NETN lysis buffer
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 118 kDa
Exposure time: 30 seconds -
Immunoprecipitation - Anti-SR140 antibody (ab195340)Detection of SR140 in Immunoprecipitates of 293T whole cell lysates prepared
using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab195340 at 6 µg per reaction for IP and at 0.1µg/ml for subsequent Western blot detection.
Detection: Chemiluminescence with an exposure time of 10 seconds.
Datasheets and documents
References
ab195340 has not yet been referenced specifically in any publications.
