Overview

  • Product name

    Anti-SRCRB4D antibody
  • Description

    Rabbit polyclonal to SRCRB4D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SRCRB4D aa 523-574.
    Sequence:

    PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLC QP


    Database link: Q8WTU2

  • Positive control

    • Human stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    SRCRB4D (Scavenger receptor cysteine rich domain containing, group B (4 domains)) is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. The scavenger receptor cysteine-rich superfamily is a highly conserved group of membrane and/or secreted proteins related to the innate and adaptive immune system.
  • Database links

  • Alternative names

    • S4D SRCRB antibody
    • Scavenger receptor cysteine rich domain containing group B (4 domains) antibody
    • Scavenger receptor cysteine rich domain containing group B antibody
    • Scavenger receptor cysteine rich protein SRCRB S4D antibody
    • SRCRB S4D antibody
    • SSC4D antibody
    see all

Images

  • Immunohistochemistry analysis of paraffin-embedded human stomach tissue labeling SRCRB4D with ab204496 at 1/200 dilution.

References

ab204496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up