Overview

  • Product name

  • Description

    Mouse polyclonal to SREBP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chinese hamster
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human SREBP2 aa 801-900. (AAH56158).
    Sequence:

    QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDS VGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT


    Database link: Q12772

  • Positive control

    • IMR-32 cell lysate; recombinant Human SREBP2 protein (immunogen).

Applications

Our Abpromise guarantee covers the use of ab194667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 123 kDa.

Target

  • Function

    Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the cholesterol and to a lesser degree the fatty acid synthesis pathway (By similarity). Binds the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') found in the flanking region of the LDRL and HMG-CoA synthase genes.
  • Tissue specificity

    Ubiquitously expressed in adult and fetal tissues.
  • Sequence similarities

    Belongs to the SREBP family.
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications

    At low cholesterol the SCAP/SREBP complex is recruited into COPII vesicles for export from the ER. In the Golgi complex SREBPs are cleaved sequentially by site-1 and site-2 protease. The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain and releases the transcription factor from the Golgi membrane. Apoptosis triggers cleavage by the cysteine proteases caspase-3 and caspase-7.
  • Cellular localization

    Nucleus and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle > COPII-coated vesicle membrane. Moves from the endoplasmic reticulum to the Golgi in the absence of sterols.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI608257 antibody
    • bHLHd2 antibody
    • Class D basic helix-loop-helix protein 2 antibody
    • OTTHUMP00000028740 antibody
    • Processed sterol regulatory element-binding protein 2 antibody
    • SRBP2_HUMAN antibody
    • SREBF 2 antibody
    • Srebf2 antibody
    • SREBF2 protein antibody
    • SREBP 2 antibody
    • SREBP-2 antibody
    • SREBP2 antibody
    • SREBP2gc antibody
    • sterol regulatory element binding factor 2 antibody
    • Sterol regulatory element binding protein 2 antibody
    • Sterol regulatory element binding transcription factor 2 antibody
    • Sterol regulatory element-binding transcription factor 2 antibody
    see all

Images

  • Anti-SREBP2 antibody (ab194667) at 1/500 dilution + IMR-32 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 123 kDa

  • Anti-SREBP2 antibody (ab194667) at 1/1000 dilution + Recombinant Human SREBP2 protein (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 123 kDa



    Predicted MWt of immunogen: 37.0 kDa.

References

ab194667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up