Overview

  • Product name

    Anti-SRGAP2C antibody
  • Description

    Rabbit polyclonal to SRGAP2C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SRGAP2C aa 1-242.
    Sequence:

    MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQ DFFRKKAEIEMDYSRNLEKLAEHFLAKTRSTKDQQFKKDQNVLSPVNCWN LLLNQVKWESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQ DDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQED RQTPCSPDSTANVRIEEKHVRRSSVKKIEKMKEKHQAKYTEN


    Database link: P0DJJ0

  • Positive control

    • IHC-P: Human colon cancer tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Involved in dendritic spine maturation through interaction with and inhibition of SRGAP2. Reduces the rate of spine maturation and indirectly increases neuronal migration. Changes dendritic spine morphology and density and may have implications for cognition, learning and memory.
  • Tissue specificity

    Ubiquitously expressed with higher expression in cerebellum. Probably expressed in fetal and adult neurons (at protein level).
  • Sequence similarities

    Contains 1 F-BAR domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • SLIT-ROBO Rho GTPase activating protein 2 pseudogene 1 antibody
    • SLIT-ROBO Rho GTPase-activating protein 2C antibody
    • SRG2C_HUMAN antibody
    • SRGAP2C antibody
    • SRGAP2P1 antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells stained for SRGAP2C (green) using ab222799 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for SRGAP2C with ab222799 at 1/100 dilution in immunohistochemical analysis.

References

ab222799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up