Overview

  • Product name

    Anti-srGAP3 antibody
  • Description

    Rabbit polyclonal to srGAP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human srGAP3 aa 905-971.
    Sequence:

    RIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKS LEAEALAEDIEKTMSTA


    Database link: O43295

  • Positive control

    • Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    GTPase-activating protein for RAC1 and perhaps Cdc42, but not for RhoA small GTPase. May attenuate RAC1 signaling in neurons.
  • Tissue specificity

    Highly expressed in adult and fetal brain. Expressed at low levels in kidney. Isoform 3 is expressed in the kidney but is absent in the brain.
  • Involvement in disease

    A chromosomal aberration involving SRGAP3 is found in a patient with severe idiopathic mental retardation. Translocation t(X;3)(p11.2;p25).
  • Sequence similarities

    Contains 1 FCH domain.
    Contains 1 Rho-GAP domain.
    Contains 1 SH3 domain.
  • Domain

    The F-BAR domain mediates oligomerization, binds membranes, and induces plasma membrane protrusions.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGAP 14 antibody
    • ARHGAP14 antibody
    • Gbi antibody
    • ME GAP antibody
    • MEGAP antibody
    • Mental disorder associated GAP antibody
    • Mental disorder-associated GAP antibody
    • Rho GTPase activating protein 14 antibody
    • Rho GTPase-activating protein 14 antibody
    • SLIT ROBO Rho GTPase activating protein 3 antibody
    • SLIT-ROBO Rho GTPase-activating protein 3 antibody
    • srGAP 2 antibody
    • srGAP 3 antibody
    • srGAP2 antibody
    • srGAP3 antibody
    • SRGP 2 antibody
    • SRGP2 antibody
    • SRGP3_HUMAN antibody
    • WAVE associated Rac GTPase activating protein antibody
    • WAVE-associated Rac GTPase-activating protein antibody
    • WRP antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling srGAP3 with ab204408 at 1/50 dilution.

References

ab204408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up