Overview

  • Product name

    Anti-SRP1 antibody
  • Description

    Rabbit polyclonal to SRP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SRP1 aa 8-538.
    Sequence:

    NFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEET EEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFR KLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASG NSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYV LDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLN VLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMH NDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKE ACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNA TSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQE AKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTE DEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL


    Database link: P52294

  • Positive control

    • IHC-P: Human lung cancer and tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
  • Tissue specificity

    Expressed ubiquitously.
  • Sequence similarities

    Belongs to the importin alpha family.
    Contains 10 ARM repeats.
    Contains 1 IBB domain.
  • Domain

    Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
    The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins.
    The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding.
  • Post-translational
    modifications

    Polyubiquitinated in the presence of RAG1 (in vitro).
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • IMA5_HUMAN antibody
    • Importin alpha 1 subunit antibody
    • Importin alpha 5 antibody
    • Importin alpha S1 antibody
    • Importin subunit alpha-5, N-terminally processed antibody
    • IPO A5 antibody
    • IPOA 5 antibody
    • IPOA5 antibody
    • Karyopherin alpha 1 antibody
    • Karyopherin alpha 1 subunit antibody
    • Karyopherin subunit alpha-1 antibody
    • KPNA 1 antibody
    • KPNA1 antibody
    • mSRP 1 antibody
    • mSRP1 antibody
    • NPI 1 antibody
    • NPI-1 antibody
    • NPI1 antibody
    • Nucleoprotein interactor 1 antibody
    • RAG cohort protein 2 antibody
    • RCH 2 antibody
    • RCH2 antibody
    • Recombination activating gene cohort 2 antibody
    • SRP 1 antibody
    • SRP1 beta antibody
    • SRP1-beta antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for SRP1 with ab238599 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for SRP1 with ab238599 at 1/100 dilution in immunohistochemical analysis.

References

ab238599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up