Overview

  • Product name

  • Description

    Rabbit polyclonal to SRP19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human SRP19 aa 2-144.
    Sequence:

    ACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQD VCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSR KSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK


    Database link: P09132

  • Positive control

    • WB: Jurkat and HeLa whole cell lysate. IHC-P: Human liver and pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human pancreas tissue stained for SRP19 using ab236585 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-SRP19 antibody (ab236585) at 1/1000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit lgG at 1/15000 dilution
  • Paraffin-embedded human liver tissue stained for SRP19 using ab236585 at 1/100 dilution in immunohistochemical analysis.

References

ab236585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up