Overview

  • Product name

  • Description

    Rabbit polyclonal to SRP68
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human SRP68 aa 430-480 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    IILQNLVELLQLPGLEEDKAFQKEIGLKTLVFKAYRCFFIAQSYVLVKKW S


    Database link: Q9UHB9

  • Positive control

    • Human endometrium carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
  • Sequence similarities

    Belongs to the SRP68 family.
  • Domain

    The RNA-binding domain is located near the N-terminus.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Signal recognition particle 68 antibody
    • Signal recognition particle 68 kDa antibody
    • Signal recognition particle 68 kDa protein antibody
    • signal recognition particle 68kD antibody
    • Signal recognition particle 68kDa antibody
    • signal recognition particle subunit SRP68 antibody
    • SRP 68 antibody
    • SRP68 antibody
    • SRP68_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human endometrium carcinoma tissue, labeling SRP68 using ab217372 at 1/200 dilution, followed by conjugation to the secondary antibody.

References

ab217372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up