Overview

  • Product name

  • Description

    Rabbit polyclonal to SRPRB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SRPRB aa 58-271.
    Sequence:

    RSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNN NRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAE FLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVT RSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGS ADIQDLEKWLAKIA


    Database link: Q9Y5M8

  • Positive control

    • WB: HepG2 and HeLa whole cell lysates. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as SRPR beta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 30 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.
  • Sequence similarities

    Belongs to the SRP receptor beta subunit family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • APMCF1 antibody
    • Protein APMCF1 antibody
    • Signal recognition particle receptor B subunit antibody
    • Signal recognition particle receptor beta subunit antibody
    • Signal recognition particle receptor subunit beta antibody
    • SR-beta antibody
    • SRbeta antibody
    • SRPR beta antibody
    • Srprb antibody
    • SRPRB_HUMAN antibody
    see all

Images

  • All lanes : Anti-SRPRB antibody (ab236725) at 1/1000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 30 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SRPRB (green) using ab236725 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up