Overview

  • Product name

  • Description

    Rabbit polyclonal to SRPRB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human SRPRB aa 181-230 (internal sequence).
    Sequence:

    QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE


    Database link: NP_067026

  • Positive control

    • Hela cell lysate.
  • General notes

     This product was previously labelled as SRPR beta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/12500.

IHC-P 1/100.

Target

  • Function

    Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.
  • Sequence similarities

    Belongs to the SRP receptor beta subunit family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • APMCF1 antibody
    • Protein APMCF1 antibody
    • Signal recognition particle receptor B subunit antibody
    • Signal recognition particle receptor beta subunit antibody
    • Signal recognition particle receptor subunit beta antibody
    • SR-beta antibody
    • SRbeta antibody
    • SRPR beta antibody
    • Srprb antibody
    • SRPRB_HUMAN antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human bronchial epithelial tissue labelling SRPRB with ab81324 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG was used as the secondary antibody. Positive staining shown in the cytoplasm. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - SRPRB. Right - Merge.

  • Western blot analysis of Jurkat cell lysates labeling SRPRB with ab81324 at 1.0µg/ml

  • Western blot analysis of 721_B cell lysates labeling SRPRB with ab81324 at 1.0µg/ml

  • Anti-SRPRB antibody (ab81324) at 1 µg/ml + Hela cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 30 kDa
    Observed band size: 32 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%

References

ab81324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up