Overview

  • Product name

  • Description

    Rabbit polyclonal to SRXN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human SRXN1 aa 76-98 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    VPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQL


    Database link: Q9BYN0

  • Positive control

    • Mouse brain cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab203613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200. Predicted molecular weight: 14 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50-1/200.

Target

  • Relevance

    SRXN1 contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. It does not act on PRDX5 or PRDX6. SRXN1 may catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • C20orf1392 antibody
    • Chromosome 20 open reading frame 139 antibody
    • dJ850E9.2 antibody
    • Npn3 antibody
    • Npn31 antibody
    • SRX1 antibody
    • SRXN 1 antibody
    • Sulfiredoxin 1 antibody
    • Sulfiredoxin 1 homolog (S. cerevisiae) antibody
    • Sulfiredoxin 1 homolog antibody
    • YKL086W antibody
    see all

Images

  • Anti-SRXN1 antibody (ab203613) at 1/200 dilution + Mouse brain cell lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/5000 dilution

    Predicted band size: 14 kDa

References

ab203613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up