Overview

  • Product name

  • Description

    Rabbit polyclonal to SSBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SSBP1 aa 7-146.
    Sequence:

    LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTI FSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGS RIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE


    Database link: Q04837

  • Positive control

    • IHC: Human esophagus tissue. WB: HEK-293, NIH/3T3 and NBT-II cell lysate. ICC/IF: A431 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 17 kDa.

Target

  • Function

    This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication.
  • Sequence similarities

    Contains 1 SSB domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • mitochondrial antibody
    • Mt SSB antibody
    • Mt-SSB antibody
    • MtSSB antibody
    • PWP1 interacting protein 17 antibody
    • PWP1-interacting protein 17 antibody
    • SENSOR OF SINGLE-STRANDED DNA COMPLEX antibody
    • Single stranded DNA binding protein 1 antibody
    • Single stranded DNA binding protein antibody
    • Single stranded DNA binding protein mitochondrial antibody
    • Single-stranded DNA-binding protein antibody
    • SOSS B1 antibody
    • SOSS COMPLEX, SUBUNIT B1 antibody
    • SSBP 1 antibody
    • SSBP antibody
    • SSBP_HUMAN antibody
    • SSBP1 antibody
    see all

Images

  • Anti-SSBP1 antibody (ab224053) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 17 kDa

  • Paraffin-embedded human esophagus tissue stained for SSBP1 using ab224053 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SSBP1 (green) using ab224053 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-SSBP1 antibody (ab224053) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 17 kDa

References

ab224053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up