Overview

  • Product name
    Anti-SSR4 antibody
  • Description
    Chicken polyclonal to SSR4
  • Host species
    Chicken
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human SSR4 aa 61-130.
    Sequence:

    VQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEE SYSLLRKAQRNNEDISIIPP

  • General notes

     This product was previously labelled as Signal sequence receptor delta

     

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituent: PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgY
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab37789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 19 kDa.

Target

Images

  • Anti-SSR4 antibody (ab37789) at 1/2000 dilution + E. coli derived fusion protein at 2.5 µg

    Secondary
    HRP conjugated Goat anti IgY at 1/1000 dilution

    Predicted band size: 19 kDa

References

ab37789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab37789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up