Overview

  • Product name

    Anti-SSSCA1 antibody
  • Description

    Rabbit polyclonal to SSSCA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human SSSCA1 aa 2-199.
    Sequence:

    ALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGE TCADCGTILLQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQL ASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPAPAVPPNTDVM


    Database link: O60232

  • Positive control

    • WB: A549, MCF7 and HEK-293T whole cell lysate. IHC-P: Human kidney and testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Might play a role in mitosis. Antigenic molecule. Could be a centromere-associated protein. May induce anti-centromere antibodies.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1500016H19Rik antibody
    • Autoantigen p27 antibody
    • C184L antibody
    • centromeric autoantigen (27kD) antibody
    • OTTHUMP00000232769 antibody
    • OTTHUMP00000233069 antibody
    • OTTHUMP00000233071 antibody
    • p27 antibody
    • Sjoegren syndrome/scleroderma autoantigen 1 antibody
    • Sjogren syndrome/scleroderma autoantigen 1 antibody
    • Sjogren's syndrome/scleroderma autoantigen 1 homolog antibody
    • SSA27_HUMAN antibody
    • SSSCA1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for SSSCA1 using ab236587 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-SSSCA1 antibody (ab236587) at 1/200 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human kidney tissue stained for SSSCA1 using ab236587 at 1/100 dilution in immunohistochemical analysis.

References

ab236587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up