Overview

  • Product name

  • Description

    Rabbit polyclonal to Ssu72
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Zebrafish
  • Immunogen

    Recombinant fragment corresponding to Human Ssu72 aa 13-188.
    Sequence:

    SSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYD QMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCE ERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCI QHTEDMENEIDELLQEFEEKSGRTFL


    Database link: Q9NP77

  • Positive control

    • 293T lysate; Human fetal liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab207849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Detects a band of approximately 23 kDa (predicted molecular weight: 23 kDa).

Target

Images

  • Anti-Ssu72 antibody (ab207849) at 1/500 dilution + 293T cell lysate

    Predicted band size: 23 kDa
    Observed band size: 23 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal liver tissue labeling Ssu72 with ab207849 at 1/100.

References

ab207849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up