Overview

  • Product name

  • Description

    Rabbit polyclonal to SSX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SSX1 aa 112-188.
    Sequence:

    MPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGK HAWTHRLRERKQLVIYEEISDPEEDDE


    Database link: Q16384

  • Positive control

    • ICC/IF: PC-3 cells. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Could act as a modulator of transcription.
  • Tissue specificity

    Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines.
  • Involvement in disease

    Note=A chromosomal aberration involving SSX1 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).
  • Sequence similarities

    Belongs to the SSX family.
    Contains 1 KRAB-related domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 5.1 antibody
    • Cancer/testis antigen family 5 member 1 antibody
    • CT5.1 antibody
    • MGC150425 antibody
    • MGC5162 antibody
    • Protein SSX1 antibody
    • sarcoma, synovial, X chromosome related 1 antibody
    • SSRC antibody
    • SSX1 antibody
    • SSX1_HUMAN antibody
    • Synovial sarcoma antibody
    • Synovial sarcoma, X breakpoint 1 antibody
    • X breakpoint 1 antibody
    see all

Images

  • PC-3 (human prostate adenocarcinoma cell line) cells labeling SSX1 using ab234815 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for SSX1 using ab234815 at 1/100 dilution in immunohistochemical analysis.

References

ab234815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up