Overview

  • Product name

  • Description

    Rabbit polyclonal to ST14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ST14 aa 566-855.
    Sequence:

    TCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARV VGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFR YSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALL ELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQK GEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEAD GRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV


    Database link: Q9Y5Y6

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Degrades extracellular matrix. Proposed to play a role in breast cancer invasion and metastasis. Exhibits trypsin-like activity as defined by cleavage of synthetic substrates with Arg or Lys as the P1 site.
  • Involvement in disease

    Defects in ST14 are a cause of ichthyosis autosomal recessive with hypotrichosis (ARIH) [MIM:610765]. ARIH is a skin disorder characterized by congenital ichthyosis associated with the presence of less than the normal amount of hair.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 CUB domains.
    Contains 4 LDL-receptor class A domains.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Epithin antibody
    • HAI antibody
    • Matriptase antibody
    • Membrane type serine protease 1 antibody
    • Membrane type serine protease antibody
    • Membrane-type serine protease 1 antibody
    • MT SP1 antibody
    • MT-SP1 antibody
    • MTSP 1 antibody
    • MTSP1 antibody
    • Prostamin antibody
    • PRSS 14 antibody
    • PRSS14 antibody
    • Serine protease 14 antibody
    • Serine protease TADG 15 antibody
    • Serine protease TADG-15 antibody
    • Serine protease TADG15 antibody
    • SNC 19 antibody
    • SNC19 antibody
    • ST 14 antibody
    • ST14 antibody
    • ST14_HUMAN antibody
    • Suppression of tumorigenicity 14 (colon carcinoma matriptase epithin) antibody
    • Suppression of tumorigenicity 14 (colon carcinoma) antibody
    • Suppression of tumorigenicity 14 antibody
    • Suppressor of tumorigenicity 14 protein antibody
    • Suppressor of tumorigenicity protein 14 antibody
    • TADG 15 antibody
    • TADG15 antibody
    • TMPRSS14 antibody
    • Tumor associated differentially expressed gene 15 protein antibody
    • Tumor-associated differentially-expressed gene 15 protein antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for ST14 with ab235925 (1/100 dilution) in immunohistochemical analysis.

References

ab235925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up