Overview

  • Product name

    Anti-ST2 antibody [6B72]
    See all ST2 primary antibodies
  • Description

    Mouse monoclonal [6B72] to ST2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Neutralisingmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ST2 aa 19-327 (extracellular). (NP_057316.3 ).
    Sequence:

    KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFAS GQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLM YSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVI DNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQ EEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRL SRKNPIDHH


    Database link: Q01638

Properties

Applications

Our Abpromise guarantee covers the use of ab196525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 63 kDa.
Neutralising Use at an assay dependent concentration.

Target

  • Function

    Receptor for interleukin-33 (IL-33), its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function.
  • Tissue specificity

    Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and the liver. Isoform C is not detected in brain, heart, liver, kidney and skeletal muscle.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DER-4 antibody
    • DER4 antibody
    • FIT 1 antibody
    • Growth stimulation expressed antibody
    • homolog of mouse growth stimulation-expressed antibody
    • Il1rl1 antibody
    • IL33R antibody
    • ILRL1_HUMAN antibody
    • Interleukin 1 receptor like 1 antibody
    • interleukin 1 receptor related protein antibody
    • Interleukin-1 receptor-like 1 antibody
    • Protein ST2 antibody
    • ST2 antibody
    • ST2L antibody
    • ST2V antibody
    • T1 antibody
    • T1 protein antibody
    see all

References

ab196525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up