Overview

  • Product name

  • Description

    Rabbit polyclonal to ST3Gal I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Full length protein corresponding to Human ST3Gal I aa 1-340.
    Sequence:

    MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENL KRLIKHRPCTCTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRW WLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGN LRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGD NVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPA FIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR


    Database link: NP_003024.1

  • Positive control

    • ST3Gal I transfected 293T cell line lysate.
  • General notes

    Previously labelled as SIAT4A. 

Properties

Applications

Our Abpromise guarantee covers the use of ab172134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function

    It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found on sugar chains O-linked to Thr or Ser and also as a terminal sequence on certain gangliosides. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
  • Tissue specificity

    Expressed in several tissues. Highest expression in lung, liver, skeletal muscle, kidney, pancreas, spleen and placenta.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 29 family.
  • Post-translational
    modifications

    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3-GalNAc-alpha-2 antibody
    • 3-sialyltransferase 1 antibody
    • 3-sialyltransferase antibody
    • 3-ST 1 antibody
    • Alpha 2 antibody
    • Alpha 23 ST antibody
    • Beta galactoside alpha 23 sialyltransferase antibody
    • Beta-galactoside alpha-2 antibody
    • beta-galactoside alpha-2,3-sialyltransferase 1 antibody
    • CMP N acetylneuraminate beta galactosamide alpha 23 sialyltransferase antibody
    • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2 antibody
    • DKFZp666E036 antibody
    • DKFZp779K2051 antibody
    • FLJ36548 antibody
    • Gal beta 13 GalNAc alpha 23 sialyltransferase antibody
    • Gal NAc6S antibody
    • Gal-beta-1 antibody
    • Gal-NAc6S antibody
    • MGC9183 antibody
    • OTTHUMP00000226912 antibody
    • OTTHUMP00000226913 antibody
    • SIA4A_HUMAN antibody
    • Sialyltransferase 4A antibody
    • SIAT4-A antibody
    • SIAT4A antibody
    • SIATFL antibody
    • ST3Gal I antibody
    • ST3GAL1 antibody
    • ST3GalA antibody
    • ST3GalA.1 antibody
    • ST3GalI antibody
    • ST3GalIA antibody
    • ST3O antibody
    see all

Images

  • All lanes : Anti-ST3Gal I antibody (ab172134) at 1 µg/ml

    Lane 1 : ST3Gal I transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/7500 dilution

    Predicted band size: 39 kDa

References

ab172134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up