Overview

  • Product name

  • Description

    Rabbit polyclonal to ST6GalNAc I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ST6GalNAc I aa 36-249.
    Sequence:

    KEPQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNA LNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVN TLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQ GKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATP PPAPFQSPTTQRNQ


    Database link: Q9NSC7

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human melanoma cancer and skin tissues.
  • General notes

    Previously labelled as ST6GALNAC1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab229816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 69 kDa (predicted molecular weight: 69 kDa).

Target

  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 29 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 6-sialyltransferase 1 antibody
    • 6-sialyltransferase I antibody
    • Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase 1 antibody
    • Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase antibody
    • Alpha-N-acetylgalactosaminide alpha-2 antibody
    • GalNAc alpha 2 6 sialyltransferase I antibody
    • GalNAc alpha-2 antibody
    • HSY11339 antibody
    • SIA7A_HUMAN antibody
    • Sialyltransferase 7A antibody
    • SIAT7-A antibody
    • SIAT7A antibody
    • ST6 (alpha N acetyl neuraminyl 2 3 beta galactosyl 1 3) N acetylgalactosaminide alpha 2 6 sialyltransferase 1 antibody
    • ST6GalNAc I antibody
    • ST6GALNAC1 antibody
    • ST6GalNAcI antibody
    • STYI antibody
    see all

Images

  • Paraffin-embedded human melanoma cancer tissue stained for ST6GalNAc I using ab229816 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for ST6GalNAc I using ab229816 at 1/100 dilution in immunohistochemical analysis.

  • Anti-ST6GalNAc I antibody (ab229816) at 1/500 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 69 kDa
    Observed band size: 69 kDa

References

ab229816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up