Overview

  • Product name

    Anti-ST8SIA5 antibody
  • Description

    Rabbit polyclonal to ST8SIA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ST8SIA5 aa 329-374.
    Sequence:

    SGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCS


    Database link: O15466

  • Positive control

    • Human cell line RT-4, Human cell line U-251MG sp and Human plasma (IgG/HSA depleted); Human hippocampus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab184777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 44 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-ST8SIA5 antibody (ab184777) at 1/100 dilution

    Lane 1 : Human cell line RT-4
    Lane 2 : Human cell line U-251MG sp
    Lane 3 : Human plasma (IgG/HSA depleted)

    Predicted band size: 44 kDa

  • Immunohistochemical analysis of Human hippocampus tissue labeling ST8SIA5 using ab184777 at a 1/500 dilution.

References

ab184777 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up