Overview

  • Product name

    Anti-ST8SiaIII antibody - C-terminal
  • Description

    Rabbit polyclonal to ST8SiaIII - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human ST8SiaIII aa 322-380 (C terminal).
    Sequence:

    WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGL TKLTLSHCA


    Database link: O43173

  • Positive control

    • ICC/IF: SH-SY5Y cells.
  • General notes

    Previously labelled as SIA8C. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

PFA-fixed/Triton X-100 permeabilized

Target

  • Function

    May transfer sialic acid through alpha-2,8-linkages to alpha-2,3-linked and alpha-2,8-linked sialic acid of N-linked oligosaccharides of glycoproteins and glycolipids. It can form polysialic acid in vitro directly on alpha-2,3-, alpha-2,6-, or alpha-2,8-linked sialic acid.
  • Tissue specificity

    Expressed in fetal and adult brain and fetal liver.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 29 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3-Gal-beta-1 antibody
    • 4-GlcNAc-R:alpha 2 antibody
    • 8-sialyltransferase 3 antibody
    • 8-sialyltransferase 8C antibody
    • 8-sialyltransferase antibody
    • 8-sialyltransferase III antibody
    • Alpha-2 antibody
    • Sia-alpha-2 antibody
    • SIA8C antibody
    • SIA8C_HUMAN antibody
    • Sialyltransferase 8C antibody
    • Sialyltransferase St8Sia III antibody
    • SIAT8-C antibody
    • ST8 alpha-N-acetyl-neuraminide alpha-2 antibody
    • St8sia3 antibody
    • ST8SiaIII antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for ST8SiaIII (green) using ab222305 at 4 µg/ml in ICC/IF.

References

ab222305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up