Overview

  • Product name

  • Description

    Rabbit polyclonal to Stabilin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Stabilin 2 aa 1550-1850.
    Sequence:

    GKVCTLINVCLTKNGGCSEFAICNHTGQVERTCTCKPNYIGDGFTCRGSI YQELPKNPKTSQYFFQLQEHFVKDLVGPGPFTVFAPLSAAFDEEARVKDW DKYGLMPQVLRYHVVACHQLLLENLKLISNATSLQGEPIVISVSQSTVYI NNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDNSGRILQNLTTLAT NNGYIKFSNLIQDSGLLSVITDPIHTPVTLFWPTDQALHALPAEQQDFLF NQDNKDKLKEYLKFHVIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGRD I


    Database link: Q8WWQ8

  • Positive control

    • IHC-P: Human spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Hyaluronan receptor that binds to and mediates endocytosis of hyaluronic acid (HA). Acts also, in different species, as a primary systemic scavenger receptor for heparin (Hep), chondroitin sulfate (CS), dermatan sulfate (DS), nonglycosaminoglycan (GAG), acetylated low-density lipoprotein (AcLDL), pro-collagen propeptides and advanced glycation end products (AGE). May serve to maintain tissue integrity by supporting extracellular matrix turnover or it may contribute to maintaining fluidity of bodily liquids by resorption of hyaluronan. Counter receptor which plays an important role in lymphocyte recruitment in the hepatic vasculature. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. The proteolytically processed 190 kDa form also functions as an endocytosis receptor for heparin internalisation as well as HA and CS.
  • Tissue specificity

    Highly expressed in sinusoidal endothelial cells of liver, spleen and lymph nodes. Also expressed in non SEC-cells such as HMDMs (monocyte-derivedmacrophages), HAMs (T-cell leukemia virus type 1-associated myelopathy), and several macrophage cell line.
  • Sequence similarities

    Contains 17 EGF-like domains.
    Contains 7 FAS1 domains.
    Contains 2 laminin EGF-like domains.
    Contains 1 Link domain.
  • Domain

    Recognizes phosphatidyl serine via its epidermal growth factor-like domains.
  • Post-translational
    modifications

    Glycosylated.
    Proteolytically processed to yield a 190 kDa protein.
  • Cellular localization

    Cell membrane. Cytoplasm. Only a small amount appears to be present at the cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • 190 kDa form stabilin-2 antibody
    • 190 kDa hyaluronan receptor for endocytosis antibody
    • EGF-like antibody
    • FAS1 EGF-like and X-link domain-containing adhesion molecule 2 antibody
    • Fasciclin antibody
    • FEEL-2 antibody
    • FEEL2 antibody
    • FELL antibody
    • FEX2 antibody
    • HARE antibody
    • Hyaluronan receptor for endocytosis antibody
    • laminin-type EGF-like and link domain-containing scavenger receptor 2 antibody
    • link domain-containing scavenger receptor 2 antibody
    • STAB-2 antibody
    • Stab2 antibody
    • STAB2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human spleen tissue stained for Stabilin 2 using ab234858 at 1/100 dilution in immunohistochemical analysis.

References

ab234858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up