Overview

  • Product name

    Anti-STAF65 gamma antibody
  • Description

    Rabbit polyclonal to STAF65 gamma
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human STAF65 gamma aa 50-133.
    Sequence:

    PTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEES EPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSD


    Database link: O94864

  • Positive control

    • Human plasma; SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 46 kDa.

Target

  • Tissue specificity

    Expressed at high levels in adenocarcinomas and gliomas and low in esophageal cancers and malignant hematological disease. Also expressed at high level in the thymus, low in peripheral blood mononuclear cells, and lowest in the stomach, small intestine, and skeletal muscle.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adenocarcinoma antigen ART1 antibody
    • ART1 antibody
    • SPT7 like STAGA complex gamma subunit antibody
    • SPT7L antibody
    • SPTF associated factor 65 gamma antibody
    • SPTF-associated factor 65 gamma antibody
    • ST65G_HUMAN antibody
    • STAF65 antibody
    • STAF65G antibody
    • STAF65gamma antibody
    • STAGA complex 65 gamma subunit antibody
    • STAGA complex 65 subunit gamma antibody
    • Suppressor of Ty 7 like antibody
    • Suppressor of Ty 7-like antibody
    • SUPT7H antibody
    • SUPT7L antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling STAF65 gamma with ab221136 at 4 µg/ml (green).

  • All lanes : Anti-STAF65 gamma antibody (ab221136) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma

    Predicted band size: 46 kDa

References

ab221136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up