Anti-STAM2 antibody (ab233290)
Key features and details
- Rabbit polyclonal to STAM2
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-STAM2 antibody
See all STAM2 primary antibodies -
Description
Rabbit polyclonal to STAM2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human, Pig -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human STAM2 aa 1-377. (Expressed in E.coli).
Sequence:MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAI MKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNK AHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQT VSAAAKNGTSSNKNKEDEDIAKAIELSLQEQKQQHTETKSLYPSSEIQLN NKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGL FPSNFVTTNLNIETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSEL NVKVLEALELYNKLVNEAPVYSVYSKL
Database link: O75886 -
Positive control
- IHC-P: Human liver and kidney tissues. WB: Recombinant human STAM2 protein; Human serum; Pig liver, brain and kidney lysates; Mouse liver lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab233290 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233290 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 58 kDa. |
Target
-
Function
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. -
Tissue specificity
Ubiquitously expressed. -
Sequence similarities
Belongs to the STAM family.
Contains 1 ITAM domain.
Contains 1 SH3 domain.
Contains 1 UIM (ubiquitin-interacting motif) repeat.
Contains 1 VHS domain. -
Domain
The VHS and UIM domains mediate the interaction with ubiquitinated proteins.
The SH3 domain mediates the interaction with USP8.
Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain. -
Post-translational
modificationsPhosphorylated in response to IL-2, GM-CSF, EGF and PDGF. -
Cellular localization
Cytoplasm. Early endosome membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10254 Human
- Entrez Gene: 56324 Mouse
- Omim: 606244 Human
- SwissProt: O75886 Human
- SwissProt: O88811 Mouse
- Unigene: 17200 Human
- Unigene: 263639 Mouse
-
Alternative names
- DKFZp564C047 antibody
- Hbp antibody
- Hrs-binding protein antibody
see all
Images
-
All lanes : Anti-STAM2 antibody (ab233290) at 1 µg/ml
Lane 1 : Human serum
Lane 2 : Pig liver lysate
Lane 3 : Pig brain lysate
Lane 4 : Pig kidney lysate
Lane 5 : Mouse liver lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 58 kDa -
Anti-STAM2 antibody (ab233290) at 1 µg/ml + Recombinant human STAM2 protein.
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 58 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-STAM2 antibody (ab233290)
Paraffin-embedded human kidney tissue stained for STAM2 using ab233290 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-STAM2 antibody (ab233290)
Paraffin-embedded human liver tissue stained for STAM2 using ab233290 at 20 µg/ml in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233290 has not yet been referenced specifically in any publications.