Anti-STAM2 antibody (ab233290)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-STAM2 antibody
See all STAM2 primary antibodies -
Description
Rabbit polyclonal to STAM2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human, Pig -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human STAM2 aa 1-377. (Expressed in E.coli).
Sequence:MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAI MKRVNHKVPHVALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNK AHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSMKEEGITFPPAGSQT VSAAAKNGTSSNKNKEDEDIAKAIELSLQEQKQQHTETKSLYPSSEIQLN NKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGL FPSNFVTTNLNIETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSEL NVKVLEALELYNKLVNEAPVYSVYSKL
Database link: O75886 -
Positive control
- IHC-P: Human liver and kidney tissues. WB: Recombinant human STAM2 protein; Human serum; Pig liver, brain and kidney lysates; Mouse liver lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab233290 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233290 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 58 kDa. |
Target
-
Function
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. -
Tissue specificity
Ubiquitously expressed. -
Sequence similarities
Belongs to the STAM family.
Contains 1 ITAM domain.
Contains 1 SH3 domain.
Contains 1 UIM (ubiquitin-interacting motif) repeat.
Contains 1 VHS domain. -
Domain
The VHS and UIM domains mediate the interaction with ubiquitinated proteins.
The SH3 domain mediates the interaction with USP8.
Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain. -
Post-translational
modificationsPhosphorylated in response to IL-2, GM-CSF, EGF and PDGF. -
Cellular localization
Cytoplasm. Early endosome membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10254 Human
- Entrez Gene: 56324 Mouse
- Omim: 606244 Human
- SwissProt: O75886 Human
- SwissProt: O88811 Mouse
- Unigene: 17200 Human
- Unigene: 263639 Mouse
-
Alternative names
- DKFZp564C047 antibody
- Hbp antibody
- Hrs-binding protein antibody
see all
Images
-
Western blot - Anti-STAM2 antibody (ab233290)All lanes : Anti-STAM2 antibody (ab233290) at 1 µg/ml
Lane 1 : Human serum
Lane 2 : Pig liver lysate
Lane 3 : Pig brain lysate
Lane 4 : Pig kidney lysate
Lane 5 : Mouse liver lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 58 kDa -
Western blot - Anti-STAM2 antibody (ab233290)Anti-STAM2 antibody (ab233290) at 1 µg/ml + Recombinant human STAM2 protein.
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 58 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-STAM2 antibody (ab233290)Paraffin-embedded human kidney tissue stained for STAM2 using ab233290 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-STAM2 antibody (ab233290)Paraffin-embedded human liver tissue stained for STAM2 using ab233290 at 20 µg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab233290 has not yet been referenced specifically in any publications.
