Overview

  • Product name

  • Description

    Rabbit polyclonal to Star-PAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to Rat Star-PAP aa 1-50 (N terminal).
    Sequence:

    MAAVDSDVVSLPRGRFRCCLCDVTTANRPSLDAHLKGRKHRDLVQLRATR


    Database link: NP_001029073

  • Positive control

    • Rat thymus lysates
  • General notes

    Previously labelled as TUT1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab139985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 94 kDa.

Target

  • Function

    Poly(A) polymerase that creates the 3'-poly(A) tail of specific pre-mRNAs. Localizes to nuclear speckles together with PIP5K1A and mediates polyadenylation of a select set of mRNAs, such as HMOX1. In addition to polyadenylation, it is also required for the 3'-end cleavage of pre-mRNAs: binds to the 3'UTR of targeted pre-mRNAs and promotes the recruitment and assembly of the CPSF complex on the 3'UTR of pre-mRNAs. In addition to adenylyltransferase activity, also has uridylyltransferase activity. However, the ATP ratio is higher than UTP in cells, suggesting that it functions primarily as a poly(A) polymerase. Acts as a specific terminal uridylyltransferase for U6 snRNA in vitro: responsible for a controlled elongation reaction that results in the restoration of the four 3'-terminal UMP-residues found in newly transcribed U6 snRNA. Not involved in replication-dependent histone mRNA degradation.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the DNA polymerase type-B-like family.
    Contains 1 C2H2-type zinc finger.
    Contains 1 PAP-associated domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated by CK1 in the proline-rich (Pro-rich) region. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus. Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha regulated poly(A) polymerase antibody
    • nuclear speckle targeted phosphatidylinositol 4 phosphate 5 kinase type I antibody
    • nuclear speckle targeted PIPK1A regulated poly(A) polymerase antibody
    • PAP associated domain containing 2 antibody
    • PAPD2 antibody
    • poly(A) polymerase associated domain containing 2 antibody
    • RBM21 antibody
    • RNA binding motif protein 21 antibody
    • RNA-binding motif protein 21 antibody
    • RNA-binding protein 21 antibody
    • Speckle targeted PIP5K1A-regulated poly(A) polymerase antibody
    • Star-PAP antibody
    • STARPAP antibody
    • STPAP_HUMAN antibody
    • terminal uridylyl transferase 1, U6 snRNA specific antibody
    • TUT1 antibody
    • TUTase antibody
    • U6 snRNA specific terminal uridylyltransferase 1 antibody
    • U6 snRNA-specific terminal uridylyltransferase 1 antibody
    • U6 TUTase antibody
    • U6-TUTase antibody
    • URLC6 antibody
    see all

Images

  • Anti-Star-PAP antibody (ab139985) at 1 µg/ml + Rat thymus lysates
    at 10 µg

    Predicted band size: 94 kDa

References

ab139985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HEK 293)
Gel Running Conditions
Reduced Non-Denaturing (Native) (10% gel)
Loading amount
30 µg
Specification
HEK 293
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Mar 29 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up