Overview

  • Product name

  • Description

    Rabbit polyclonal to Star-PAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human Star-PAP aa 215-264 (N terminal).
    Sequence:

    DLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDSQ


    Database link: NP_073741

  • Positive control

    • 293T cell lysate.
  • General notes

    Previously labelled as TUT1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab86161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 94 kDa (predicted molecular weight: 94 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Poly(A) polymerase that creates the 3'-poly(A) tail of specific pre-mRNAs. Localizes to nuclear speckles together with PIP5K1A and mediates polyadenylation of a select set of mRNAs, such as HMOX1. In addition to polyadenylation, it is also required for the 3'-end cleavage of pre-mRNAs: binds to the 3'UTR of targeted pre-mRNAs and promotes the recruitment and assembly of the CPSF complex on the 3'UTR of pre-mRNAs. In addition to adenylyltransferase activity, also has uridylyltransferase activity. However, the ATP ratio is higher than UTP in cells, suggesting that it functions primarily as a poly(A) polymerase. Acts as a specific terminal uridylyltransferase for U6 snRNA in vitro: responsible for a controlled elongation reaction that results in the restoration of the four 3'-terminal UMP-residues found in newly transcribed U6 snRNA. Not involved in replication-dependent histone mRNA degradation.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the DNA polymerase type-B-like family.
    Contains 1 C2H2-type zinc finger.
    Contains 1 PAP-associated domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated by CK1 in the proline-rich (Pro-rich) region. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus. Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha regulated poly(A) polymerase antibody
    • nuclear speckle targeted phosphatidylinositol 4 phosphate 5 kinase type I antibody
    • nuclear speckle targeted PIPK1A regulated poly(A) polymerase antibody
    • PAP associated domain containing 2 antibody
    • PAPD2 antibody
    • poly(A) polymerase associated domain containing 2 antibody
    • RBM21 antibody
    • RNA binding motif protein 21 antibody
    • RNA-binding motif protein 21 antibody
    • RNA-binding protein 21 antibody
    • Speckle targeted PIP5K1A-regulated poly(A) polymerase antibody
    • Star-PAP antibody
    • STARPAP antibody
    • STPAP_HUMAN antibody
    • terminal uridylyl transferase 1, U6 snRNA specific antibody
    • TUT1 antibody
    • TUTase antibody
    • U6 snRNA specific terminal uridylyltransferase 1 antibody
    • U6 snRNA-specific terminal uridylyltransferase 1 antibody
    • U6 TUTase antibody
    • U6-TUTase antibody
    • URLC6 antibody
    see all

Images

  • Anti-Star-PAP antibody (ab86161) at 1 µg/ml (5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 94 kDa
    Observed band size: 94 kDa
    Additional bands at: >168 kDa, 45 kDa, 70 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 6-18%

References

ab86161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up