Overview

  • Product name

    Anti-START domain containing 7 antibody
    See all START domain containing 7 primary antibodies
  • Description

    Rabbit polyclonal to START domain containing 7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human START domain containing 7 aa 272-359.
    Sequence:

    VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMA TLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE


    Database link: Q9NQZ5

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signalling mediated by lipid binding. Two alternatively spliced transcript variants that encode an identical protein have been reported.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • Gestational trophoblastic tumor protein 1 antibody
    • GTT1 antibody
    • Hypothetical protein STARD7 antibody
    • Protein GTT1 antibody
    • StAR related lipid transfer protein 7 antibody
    • StAR related lipid transfer protein 7 mitochondrial antibody
    • StAR-related lipid transfer protein 7, mitochondrial antibody
    • StARD7 antibody
    • START domain containing protein 7 antibody
    • START domain-containing protein 7 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for START domain containing 7 (green) using ab221569 at 4 µg/ml in ICC/IF. 

References

ab221569 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up