
  • Product name
    Anti-STAT1 antibody [SM2]
    See all STAT1 primary antibodies
  • Description
    Mouse monoclonal [SM2] to STAT1
  • Host species
  • Specificity
    The antibody recognizes an epitope included within amino acids 8-23 of the 91 kDa STAT 1 protein.
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide:


    conjugated to KLH, corresponding to N terminal amino acids 8-23 of Human STAT1.



Our Abpromise guarantee covers the use of ab14743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent dilution.
WB Use at an assay dependent dilution. Predicted molecular weight: 90 kDa.


  • Function
    Signal transducer and activator of transcription that mediates signaling by interferons (IFNs). Following type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. In response to type II IFN (IFN-gamma), STAT1 is tyrosine- and serine-phosphorylated. It then forms a homodimer termed IFN-gamma-activated factor (GAF), migrates into the nucleus and binds to the IFN gamma activated sequence (GAS) to drive the expression of the target genes, inducing a cellular antiviral state.
  • Involvement in disease
    Note=STAT1 deficiency results in impaired immune response leading to severe mycobacterial and viral diseases. In the case of complete deficiency, patients can die of viral disease.
    Defects in STAT1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
  • Sequence similarities
    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    Phosphorylated on tyrosine and serine residues in response to IFN-alpha, IFN-gamma, PDGF and EGF. Phosphorylation on Tyr-701 (lacking in beta form) by JAK promotes dimerization and subsequent translocation to the nucleus. Phosphorylation on Ser-727 by several kinases including MAPK14, ERK1/2 and CAMKII on IFN-gamma stimulation, regulates STAT1 transcriptional activity. Phosphorylation on Ser-727 promotes sumoylation though increasing interaction with PIAS. Phosphorylation on Ser-727 by PKCdelta induces apoptosis in response to DNA-damaging agents.
    Sumoylated by SUMO1, SUMO2 and SUMO3. Sumoylation is enhanced by IFN-gamma-induced phosphorylation on Ser-727, and by interaction with PIAS proteins. Enhances the transactivation activity.
  • Cellular localization
    Cytoplasm. Nucleus. Translocated into the nucleus in response to IFN-gamma-induced tyrosine phosphorylation and dimerization.
  • Information by UniProt
  • Database links
  • Alternative names
    • Signal transducer and activator of transcription 1 91kD antibody
    • CANDF7 antibody
    • DKFZp686B04100 antibody
    • IMD31A antibody
    • IMD31B antibody
    • IMD31C antibody
    • ISGF 3 antibody
    • ISGF-3 antibody
    • OTTHUMP00000163552 antibody
    • OTTHUMP00000165046 antibody
    • OTTHUMP00000165047 antibody
    • OTTHUMP00000205845 antibody
    • Signal transducer and activator of transcription 1 91kDa antibody
    • Signal transducer and activator of transcription 1 antibody
    • Signal transducer and activator of transcription 1, 91kD antibody
    • Signal transducer and activator of transcription 1-alpha/beta antibody
    • STAT 1 antibody
    • Stat1 antibody
    • STAT1_HUMAN antibody
    • STAT91 antibody
    • Transcription factor ISGF 3 components p91 p84 antibody
    • Transcription factor ISGF-3 components p91/p84 antibody
    see all


This product has been referenced in:
  • Gatliff J  et al. A role for TSPO in mitochondrial Ca2+ homeostasis and redox stress signaling. Cell Death Dis 8:e2896 (2017). Read more (PubMed: 28640253) »
  • Gatliff J  et al. TSPO interacts with VDAC1 and triggers a ROS-mediated inhibition of mitochondrial quality control. Autophagy 10:2279-96 (2014). Read more (PubMed: 25470454) »
See all 4 Publications for this product

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Abcam has not validated the combination of species/application used in this Abreview.
Western blot
Salmo salar Cell lysate - whole cell (cell line)
Loading amount
100000 cells
cell line
Gel Running Conditions
Reduced Denaturing (4 - 12%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Mar 08 2012


The codes will be activated only once we receive your Abreviews. As explained in a previous email, the testing offer works as follow : 1. Purchase the antibody to be tested. 2. Test the antibodies 3. Let us know the results, positive or negative, using our Abreview system. To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews . 4. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any priamry antibody ordered and the discount code is valid for 4 months after issue. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount . I hope this is helpful.  

Read More


The TYK2 antibody has not been tested yet in other application but IHC-P and ELISA. If it was not suitable for a tested application this information would appear on the datasheet. The monoclonal STAT1 antibody has the advantage to have no variability in the way it binds to the target. Since the homology is not 100%, it may be a straight yes or no answer. It would be much more difficult to characterise the suitability of a polyclonal for the salmon species due to its high variability in the binding of the target. DISCOUNT CODE for ab14743 : *********** DISCOUNT CODE for ab39550 : *********** Expiration date for both codes : DD MM YYYY We are very pleased to hear you would like to accept our offer and test ab14743 and ab39550 in Salmon. This code will give you 1 free primary antibody before the expiration date. To redeem this offer, please submit an Abreview for salmon samples and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews. Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More



Read More

Thank you for providing this information. For the detection of TYK2, I selected the following antibodies : - ab39550 : non-phospho peptide around Tyr 1054. 79% when comparing the region aa 1045-1064 (which is not the exact immunogen sequence, only the region) - ab54493 that recognizes TYK2 phosphorylated at Tyr1054/1055. It does not recognize non-phosphorylated TYK2. 79% when comparing the region aa 1045-1064 (which is not the exact immunogen sequence, only the region) - ab108064 78% : ab108064 HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP salmon     HRDLAARNVLVENEHLVKIGDFGLTKYIPEGDVYYRVREDGDSPVYWYAI               **********::*::*********:* :***. ************:***   For the detection of STAT1, I fselected the followinf antibody : - ab14743 73%homology with the Salmon STAT1 : ab14743 QLDSKFLEQVHQLYD STAT1A  LLESKYLEQVDQLYD              *:**:****.****   To our knowledge, the antibodies listed above have not been tested in Salmon samples. Therefore, I can offer a discount off a future purchase if you buy one of the anti-TYK2 and/or ab14743 now, test it in Salmon and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody. If you are interested in this offer, please follow these steps: 1. Reply to this e-mail to let me know that you would like to proceed and test one of the anti-TYK2 and/or ab14743 in Salmon. I will then send a discount code. This code must be issued before purchasing the antibodies so please wait for my reply before ordering. 2. Purchase one of the anti-TYK2 and/or ab14743 either by phone, fax, or online (www.abcam.com). 3. Test it in Salmon. 4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews. 5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue. We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if the tested antibody turns out to be unsuitable for Salmon, you will still receive the discount on your next purchase after your Abreview has been submitted. Please let me know if you have any questions about this offer and I would be happy to help you further. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.    

Read More


Thank you for getting back to me. I am sorry that you are unhappy with the way that we market our antibodies. I agree with you that this is a relatively concentrated antibody given that it is a monoclonal antiserum. However, as stipulated on the datasheet this antibody should be applied at an assay dependent dilution. That is to say it should be applied at a dilution range initially and subsequent experiments modified according to the result. Many of our antibodies in particular monoclonal antibodies should be applied at a dilution significantly less than 1:1000. I appreciate the further information that you have provided me with with regards the use of BSA/TBST as a blocking agent. However, I would still like to recommend that you reduce the dilution of the antibody to 1:200 to gage whether the antibody is capable of detecting its target at this dilution. A dilution of 1:1000 may be outside of its threshold of its detection. I am in no way suggesting that the experimental failure that you have been experiencing is a result of your own technical failure. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More


Thank you for your enquiry. I am sorry to hear that you have been having difficulties with this antibody. Quality is important to Abcam. The system that you are using sounds perfect for comparing this antibody and it is alarming that you have not been able to detect Stat1 using this antibody but have been successful using other commercially available antibodies. I would very much appreciate it if you could e-mail me some representative blots. I would also be very interested in the dilutions that you have applied this antibody at. You mention "only 1:1000". However, the antibody dilution should be determined by the end user and it is possible that you may need to reduce the dilution of this antibody to detect Stat1; for example 1:200 etc. We also find that a change to the antibody blocking solution can result in improved (more sensitive, specific) results. We recommend 3% BSA as a blocking agent and frequently find that it generates better results that non-fat dry milk. I look forward to hearing from you.

Read More


Sign up