Overview

  • Product name

  • Description

    Rabbit polyclonal to STAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Rat STAT2 aa 587-838.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRRLLKKMVSGTFLL RFSETSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQV LAEENAPENPLRFLYPRVPRDEAFGCYYQEKVNLEERRKYLKHRLIVISN RQADELQQPLELKQDPESLELDAELMSVMELARDLELQSMLQVGLDLGVE PKPDPTLSPAPQILLEPDPARALNQLLPEPDLPQDLQQLNTGEMEIFRNN INIDDVMPYGDPVLAGQSIIEEAYRSCPSHFDVDGPLI


    Database link: Q5XI26

  • Positive control

    • WB: Recombinant rat STAT2 protein; Rat serum; Mouse lung lysate. IHC-P: Rat stomach, adrenal gland, liver, spinal cord, skin and lung tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 97 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Signal transducer and activator of transcription that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.
  • Sequence similarities

    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated in response to IFN-alpha.
  • Cellular localization

    Cytoplasm. Nucleus. Translocated into the nucleus upon activation by IFN-alpha/beta.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homo sapiens interferon alpha induced transcriptional activator antibody
    • interferon alpha induced transcriptional activator antibody
    • ISGF 3 antibody
    • ISGF3 antibody
    • MGC59816 antibody
    • P113 antibody
    • signal transducer and activator of transcription 2 113kD antibody
    • Signal transducer and activator of transcription 2 antibody
    • STAT113 antibody
    • Stat2 antibody
    • STAT2_HUMAN antibody
    see all

Images

  • Anti-STAT2 antibody (ab231184) at 3 µg + Recombinant rat STAT2 protein

    Predicted band size: 97 kDa

  • All lanes : Anti-STAT2 antibody (ab231184) at 3 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Mouse lung lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 97 kDa

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for STAT2 with ab231184 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat adrenal gland tissue stained for STAT2 with ab231184 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for STAT2 with ab231184 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for STAT2 with ab231184 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat skin tissue stained for STAT2 with ab231184 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat lung tissue stained for STAT2 with ab231184 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:

  • Guan G  et al. Down-regulation of IFIT3 protects liver from ischemia-reperfusion injury. Int Immunopharmacol 60:170-178 (2018). WB ; Mouse . Read more (PubMed: 29734133) »
  • Zhang J  et al. Identification of NPAC as a novel biomarker and regulator for hepatocellular carcinoma. J Cell Biochem N/A:N/A (2018). Read more (PubMed: 30474880) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up