Overview

  • Product name

  • Description

    Rabbit polyclonal to STAT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human STAT2 aa 616-849. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    EHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLY PRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPE PELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEP TLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEI MPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPS


    Database link: P52630

  • Positive control

    • IHC-P: Human stomach, kidney, stomach cancer and liver tissues. WB: K562 and HeLa cell lysates; Pig liver lysate; Recombinant human STAT2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 97 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Signal transducer and activator of transcription that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.
  • Sequence similarities

    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated in response to IFN-alpha.
  • Cellular localization

    Cytoplasm. Nucleus. Translocated into the nucleus upon activation by IFN-alpha/beta.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homo sapiens interferon alpha induced transcriptional activator antibody
    • interferon alpha induced transcriptional activator antibody
    • ISGF 3 antibody
    • ISGF3 antibody
    • MGC59816 antibody
    • P113 antibody
    • signal transducer and activator of transcription 2 113kD antibody
    • Signal transducer and activator of transcription 2 antibody
    • STAT113 antibody
    • Stat2 antibody
    • STAT2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for STAT2 using ab233177 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for STAT2 using ab233177 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for STAT2 using ab233177 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-STAT2 antibody (ab233177) at 2 µg/ml + Recombinant human STAT2 protein

    Predicted band size: 97 kDa

  • Anti-STAT2 antibody (ab233177) at 2 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Predicted band size: 97 kDa

  • Anti-STAT2 antibody (ab233177) at 2 µg/ml + Pig liver tissue lysate

    Predicted band size: 97 kDa

  • Anti-STAT2 antibody (ab233177) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 97 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for STAT2 using ab233177 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab233177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Cat Tissue sections (spleen, liver, neoplasia, MLN, many)
Antigen retrieval step
Other
Permeabilization
No
Specification
spleen, liver, neoplasia, MLN, many
Blocking step
(agent) for 10 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Dec 07 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up