Overview

  • Product name

  • Description

    Rabbit polyclonal to STAT4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human STAT4 aa 569-748.
    Sequence:

    WIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESG EVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKD KAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLL PMSPSVYAVLRENLSPTTIETAMKSPYSAE


    Database link: Q14765

  • Positive control

    • WB: HepG2, HeLa, PC-3 and K562 whole cell lysate; Mouse brain lysate; Rat liver tissue lysate. IHC-P: Human liver cancer and small intestine tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    Carries out a dual function: signal transduction and activation of transcription. Involved in IL12 signaling.
  • Involvement in disease

    Systemic lupus erythematosus 11
    Rheumatoid arthritis
  • Sequence similarities

    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated. Serine phosphorylation is also required for maximal transcriptional activity.
  • Cellular localization

    Cytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Signal transducer and activator of transcription 4 antibody
    • SLEB11 antibody
    • STAT4 antibody
    • STAT4_HUMAN antibody

Images

  • All lanes : Anti-STAT4 antibody (ab235946) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 4 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 5 : Mouse brain tissue lysate
    Lane 6 : Rat liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human small intestine tissue stained for STAT4 using ab235946 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling STAT4 using ab235946 at 1/100 dilution in ICC/IF. Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

  • Paraffin-embedded human liver cancer tissue stained for STAT4 using ab235946 at 1/100 dilution in immunohistochemical analysis.

References

ab235946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up