Overview

  • Product name

    Anti-STAT6 antibody [STAT6/2410]
    See all STAT6 primary antibodies
  • Description

    Mouse monoclonal [STAT6/2410] to STAT6
  • Host species

    Mouse
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human STAT6.
    Sequence:

    MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCC NLASALLSDTVQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFR QILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREA LQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKR IQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELE PKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENS IPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLP IQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEK MCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWS QFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSL LLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTV ERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSI PPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQ EHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQ DLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW


    Database link: P42226-1

  • Positive control

    • IHC-P: Human renal cell carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Incubate with primary ab for 30 minutes at RT

Target

  • Function

    Carries out a dual function: signal transduction and activation of transcription. Involved in interleukin-4 signalling.
  • Sequence similarities

    Belongs to the transcription factor STAT family.
    Contains 1 SH2 domain.
  • Post-translational
    modifications

    Tyrosine phosphorylated following stimulation by IL-4 and IL-3.
  • Cellular localization

    Cytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
  • Information by UniProt
  • Database links

  • Alternative names

    • 12S1644 antibody
    • D12S1644 antibody
    • IL 4 STAT antibody
    • IL-4 Stat antibody
    • IL4 STAT antibody
    • Interleukin 4 Induced antibody
    • Interleukin 4 Induced Transcription Factor IL4 STAT antibody
    • Signal transducer and activator of transcription 6 antibody
    • Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced antibody
    • Signal Transducer And Activator Of Transcription 6 Nirs Variant 1 antibody
    • Signal transducer and activator of transcription 6, interleukin 4 induced antibody
    • STAT 6 antibody
    • STAT interleukin4 induced antibody
    • STAT, interleukin4 induced antibody
    • Stat6 antibody
    • STAT6_HUMAN antibody
    • STAT6B antibody
    • STAT6C antibody
    • Transcription factor IL 4 STAT antibody
    see all

Images

  • ab238059 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Formalin-fixed, paraffin-embedded human renal cell carcinoma tissue stained for STAT6 using ab238059 at 2 μg/mL in immunohistochemical analysis.

References

ab238059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up