Anti-STBD1 antibody (ab172352)
Key features and details
- Rabbit polyclonal to STBD1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-STBD1 antibody
See all STBD1 primary antibodies -
Description
Rabbit polyclonal to STBD1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human STBD1 aa 1-358.
Sequence:MGAVWSALLVGGGLAGALFVWLLRGGPGDTGKDGDAEQEKDAPLGGAAIP GGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRL QNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPM GEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDH EEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGK MERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLH YNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKV VHAWWGIH
Database link: NP_003934.1 -
Positive control
- STBD1 transfected 293T cell lysate.
-
General notes
Previously labelled as Genethonin 1.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab172352 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. |
Target
-
Function
May have the capability to bind to carbohydrates. -
Tissue specificity
Expressed at high level in skeletal and cardiac muscles. Moderately expressed in liver and placenta. No expression is found in pancreas, kidney or lung. Present in skeletal muscle, heart and placenta (at protein level). -
Sequence similarities
Contains 1 CBM20 (carbohydrate binding type-20) domain. -
Cellular localization
Membrane. Distributed in the transverse tubules and/or near the junctional sarcoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 8987 Human
- Omim: 607406 Human
- SwissProt: O95210 Human
- Unigene: 109590 Human
- Unigene: 720509 Human
-
Alternative names
- FLJ41801 antibody
- Genethonin 1 antibody
- Genethonin-1 antibody
see all
Images
-
All lanes : Anti-STBD1 antibody (ab172352) at 1 µg/ml
Lane 1 : STBD1 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Rabbit IgG (H+L), peroxidase conjugate at 1/7500 dilution
Predicted band size: 39 kDa
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172352 has not yet been referenced specifically in any publications.