Overview

  • Product name

    Anti-Steroid sulfatase antibody
    See all Steroid sulfatase primary antibodies
  • Description

    Rabbit polyclonal to Steroid sulfatase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Steroid sulfatase aa 248-364.
    Sequence:

    YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSK DFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHV EEVSSKGEIHGGSNGIY


    Database link: P08842

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Conversion of sulfated steroid precursors to estrogens during pregnancy.
  • Involvement in disease

    Defects in STS are the cause of ichthyosis X-linked (IXL) [MIM:308100]. Ichthyosis X-linked is a keratinization disorder manifesting with mild erythroderma and generalized exfoliation of the skin within a few weeks after birth. Affected boys later develop large, polygonal, dark brown scales, especially on the neck, extremities, trunk, and buttocks.
  • Sequence similarities

    Belongs to the sulfatase family.
  • Post-translational
    modifications

    The conversion to 3-oxoalanine (also known as C-formylglycine, FGly), of a serine or cysteine residue in prokaryotes and of a cysteine residue in eukaryotes, is critical for catalytic activity.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARSC antibody
    • ARSC1 antibody
    • Arylsulfatase C antibody
    • Arylsulfatase C isozyme S antibody
    • ASC antibody
    • EC 3.1.6.2 antibody
    • ES antibody
    • Estrone sulfatase antibody
    • SSDD antibody
    • Steroid sulfatase (microsomal) antibody
    • Steroid sulfatase (microsomal) arylsulfatase C isozyme S antibody
    • Steroid sulfatase antibody
    • Steryl sulfatase antibody
    • Steryl sulfatase precursor antibody
    • Steryl sulfate sulfohydrolase antibody
    • Steryl-sulfatase antibody
    • Steryl-sulfate sulfohydrolase antibody
    • STS antibody
    • STS_HUMAN antibody
    see all

Images

  • Paraffin embedded sections of human placenta were stained for Steroid sulfatase with ab223708 at 1/50 dilution in immunohistochemical analysis.

References

ab223708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up