Overview

  • Product name

    Anti-Steroid sulfatase antibody
    See all Steroid sulfatase primary antibodies
  • Description

    Rabbit polyclonal to Steroid sulfatase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Steroid sulfatase aa 235-583. Expressed in E. coli. N-terminal tags. 2nd Lumenal domain.
    Sequence:

    HYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVL SYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLAND TLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRW PRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKS QRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFAT HVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAA DRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR


    Database link: P08842

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human Steroid sulfatase protein. Mouse testis and placenta lysate; Human serum.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Conversion of sulfated steroid precursors to estrogens during pregnancy.
  • Involvement in disease

    Defects in STS are the cause of ichthyosis X-linked (IXL) [MIM:308100]. Ichthyosis X-linked is a keratinization disorder manifesting with mild erythroderma and generalized exfoliation of the skin within a few weeks after birth. Affected boys later develop large, polygonal, dark brown scales, especially on the neck, extremities, trunk, and buttocks.
  • Sequence similarities

    Belongs to the sulfatase family.
  • Post-translational
    modifications

    The conversion to 3-oxoalanine (also known as C-formylglycine, FGly), of a serine or cysteine residue in prokaryotes and of a cysteine residue in eukaryotes, is critical for catalytic activity.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARSC antibody
    • ARSC1 antibody
    • Arylsulfatase C antibody
    • Arylsulfatase C isozyme S antibody
    • ASC antibody
    • EC 3.1.6.2 antibody
    • ES antibody
    • Estrone sulfatase antibody
    • SSDD antibody
    • Steroid sulfatase (microsomal) antibody
    • Steroid sulfatase (microsomal) arylsulfatase C isozyme S antibody
    • Steroid sulfatase antibody
    • Steryl sulfatase antibody
    • Steryl sulfatase precursor antibody
    • Steryl sulfate sulfohydrolase antibody
    • Steryl-sulfatase antibody
    • Steryl-sulfate sulfohydrolase antibody
    • STS antibody
    • STS_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Steroid sulfatase with ab233233 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Steroid sulfatase antibody (ab233233) at 1 µg/ml + Mouse testis tissue lysate

    Predicted band size: 65 kDa

  • Anti-Steroid sulfatase antibody (ab233233) at 1 µg/ml + Human serum

    Predicted band size: 65 kDa

  • Anti-Steroid sulfatase antibody (ab233233) at 1 µg/ml + Mouse placenta tissue lysate

    Predicted band size: 65 kDa

  • Anti-Steroid sulfatase antibody (ab233233) at 1 µg/ml + Recombinant human Steroid sulfatase protein

    Predicted band size: 65 kDa

References

ab233233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Liver)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citraconic acid
Permeabilization
No
Specification
Liver
Blocking step
Serum as blocking agent for 20 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Paraformaldehyde

Mr. Vincent Pacini

Verified customer

Submitted Aug 20 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up