Stichodactyla Toxin, voltage-dependent K+ channel blocker (ab141864)

Overview

  • Product name

    Stichodactyla Toxin, voltage-dependent K+ channel blocker
  • Description

    Highly potent voltage-dependent K+ channel blocker
  • Biological description

    Highly potent voltage-dependent K+ channel blocker (IC50 values are 16,11 and 312 pM and 0.3-6, 9, 12, 30 and 170 nM for KV1.1, KV1.3, KV1.4, KV1.2, KV3.2, KV1.7 KCa3.1 and KV1.6 respectively). Competes with Dendrotoxin I (Asc 1794) and α-Dendrotoxin (Asc 1791) to bind to synaptosomal membranes of rat brain (IC50 values are 1 nM and 20 pM respectively). Shows immunomodulatory effects in vivo.
  • Purity

    > 98%
  • CAS Number

    172450-46-3
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4055.00
  • Molecular formula

    C169H274N54O48S7
  • Sequence

    RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Modifications: Disulfide bonds: 3-35, 12-28, 17-32)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water

  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Beeton C  et al. Analogs of the sea anemone potassium channel blocker ShK for the treatment of autoimmune diseases. Inflamm Allergy Drug Targets 10:313-21 (2011). Read more (PubMed: 21824083) »
  • Castañeda O  et al. Characterization of a potassium channel toxin from the Caribbean Sea anemone Stichodactyla helianthus. Toxicon 33:603-13 (1995). Read more (PubMed: 7660365) »
  • Pennington MW  et al. Chemical synthesis and characterization of ShK toxin: a potent potassium channel inhibitor from a sea anemone. Int J Pept Protein Res 46:354-8 (1995). Read more (PubMed: 8567178) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up