Overview

  • Product name

  • Description

    Rabbit polyclonal to STIL/SIL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human STIL/SIL aa 388-637.
    Sequence:

    MPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLVLDGNFIE SNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEAGEPSLRG IPNQLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEK LQTVSAGNVQNEEYPIRPSTLNSRQSSLAPQSQPHDFVFSPHNSGRPMEL QIPTPPLPSYCSTNVCRCCQHHSHIQYSPLNSWQGANTVGSIQDVQSEAL


    Database link: Q15468

  • Positive control

    • IHC-P: Human lung and breast cancer tissues. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as STIL

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Immediate-early gene. Plays an important role in embryonic development as well as in cellular growth and proliferation; its long-term silencing affects cell survival and cell cycle distribution as well as decreases CDK1 activity correlated with reduced phosphorylation of CDK1. Play a role as a positive regulator of the sonic hedgehog pathway, acting downstream of PTCH1.
  • Tissue specificity

    Expressed in all hematopoietic tissues and cell lines. Highly expressed in a variety of tumors characterized by increased mitotic activity with highest expression in lung cancer.
  • Involvement in disease

    Note=A chromosomal aberration involving STIL may be a cause of some T-cell acute lymphoblastic leukemias (T-ALL). A deletion at 1p32 between STIL and TAL1 genes leads to STIL/TAL1 fusion mRNA with STIL exon 1 slicing to TAL1 exon 3. As both STIL exon 1 and TAL1 exon 3 are 5'-untranslated exons, STIL/TAL1 fusion mRNA predicts a full length TAL1 protein under the control of the STIL promoter, leading to inappropriate TAL1 expression. In childhood T-cell malignancies (T-ALL), a type of defect such as STIL/TAL1 fusion is associated with a good prognosis. In cultured lymphocytes from healthy adults, STIL/TAL1 fusion mRNA may be detected after 7 days of culture.
    Defects in STIL are the cause of microcephaly primary type 7 (MCPH7) [MIM:612703]. Microcephaly is defined as a head circumference more than 3 standard deviations below the age-related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits.
  • Post-translational
    modifications

    Phosphorylated following the activation of the mitotic checkpoint.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686O09161 antibody
    • MCPH7 antibody
    • OTTHUMP00000009566 antibody
    • SCL interrupting locus protein antibody
    • SCL-interrupting locus protein antibody
    • SCL/TAL1 interrupting locus antibody
    • SIL antibody
    • STIL antibody
    • STIL_HUMAN antibody
    • TAL 1 interrupting locus protein antibody
    • TAL-1-interrupting locus protein antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for STIL/SIL (green) using ab222838 at 1/100 dilution in ICC/IF. Alexa Fluor 488-congugated Goat Anti-Rabbit IgG(H+L) was used as secondary antibody.

  • Paraffin-embedded human breast cancer tissue stained for STIL/SIL using ab222838 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for STIL/SIL using ab222838 at 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Wu X  et al. The human oncogene SCL/TAL1 interrupting locus (STIL) promotes tumor growth through MAPK/ERK, PI3K/Akt and AMPK pathways in prostate cancer. Gene 686:220-227 (2019). Read more (PubMed: 30453068) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up